General Information

  • ID:  hor006753
  • Uniprot ID:  Q3HRV5
  • Protein name:  Glycoprotein hormones alpha chain
  • Gene name:  CGA
  • Organism:  Aotus nancymaae (Ma's night monkey)
  • Family:  Glycoprotein hormones subunit alpha family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Aotus (genus), Aotidae (family), Platyrrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0016913 follicle-stimulating hormone activity
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0010469 regulation of signaling receptor activity; GO:0010893 positive regulation of steroid biosynthetic process
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0016914 follicle-stimulating hormone complex; GO:0061696 pituitary gonadotropin complex

Sequence Information

  • Sequence:  VPDGDFTAQECPECKLKENKYFSKLGAPVYQCAGCCFSRAYPTPVRSQKTMSVPKNVTSESSCCVAKTYTKATVMGNIKVENHTECHCSTCYHHKF
  • Length:  96
  • Propeptide:  MDSYRKYAAVILVTLLVFLHSLHSVPDGDFTAQECPECKLKENKYFSKLGAPVYQCAGCCFSRAYPTPVRSQKTMSVPKNVTSESSCCVAKTYTKATVMGNIKVENHTECHCSTCYHHKF
  • Signal peptide:  MDSYRKYAAVILVTLLVFLHSLHS
  • Modification:  NA
  • Glycosylation:  T56 N-linked (GlcNAc...) asparagine;T82 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH, follitropin/follicle stimulating hormone/FSH and choriogonadotropin/CG. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  11-35; 14-64; 32-86; 36-88; 63-91
  • Structure ID:  AF-Q3HRV5-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006753_AF2.pdbhor006753_ESM.pdb

Physical Information

Mass: 1237588 Formula: C460H715N127O142S12
Absent amino acids: W Common amino acids: CKT
pI: 8.26 Basic residues: 16
Polar residues: 40 Hydrophobic residues: 21
Hydrophobicity: -49.17 Boman Index: -16537
Half-Life: 100 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 42.6
Instability Index: 6687.4 Extinction Coefficient cystines: 8075
Absorbance 280nm: 85

Literature

  • PubMed ID:  17897645
  • Title:  Molecular cloning of pituitary glycoprotein alpha-subunit and follicle stimulating hormone and chorionic gonadotropin beta-subunits from New World squirrel monkey and owl monkey.